PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_13602.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 146aa    MW: 17387.8 Da    PI: 9.4622
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_13602.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.65.8e-5471351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eelv +yLk+k+++ k++l +vi ++d+y++ePwd++      ++ee+ewyfFs++d+ky+tg+r+nrat++g+W
  Sme2.5_13602.1_g00002.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVIIDIDLYRMEPWDIQDrckLGYEEESEWYFFSHKDRKYPTGTRTNRATSAGFW 91 
                              69****************************.99**************952422233667*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk+vls k++ +g++ktLvfy+grap+g+k+dW+mheyrl
  Sme2.5_13602.1_g00002.1  92 KATGRDKTVLS-KEKIIGMRKTLVFYRGRAPNGRKSDWIMHEYRL 135
                              ***********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-574140IPR003441NAC domain
PROSITE profilePS5100554.0757146IPR003441NAC domain
PfamPF023651.9E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MEMESYVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVII DIDLYRMEPW DIQDRCKLGY  60
EEESEWYFFS HKDRKYPTGT RTNRATSAGF WKATGRDKTV LSKEKIIGMR KTLVFYRGRA  120
PNGRKSDWIM HEYRLQTSQH GPPQVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-49213510140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869361e-170JQ686936.1 Nicotiana tabacum cultivar SR1 NAC domain-containing protein 7 (VND7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057939.11e-101PREDICTED: NAC domain-containing protein 30
SwissprotQ9C8W91e-88NAC30_ARATH; NAC domain-containing protein 30
TrEMBLK4D6S01e-101K4D6S0_SOLLC; Uncharacterized protein
STRINGSolyc11g018660.1.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-82vascular related NAC-domain protein 7